B4GALNT1 Antikörper (N-Term)

Produktnummer ABIN635951

Produktdetails anti-B4GALNT1 Antikörper

Target: B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser B4GALNT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: B4 GALNT1 antibody was raised against the N terminal of B4 ALNT1

Aufreinigung: Affinity purified

Immunogen: B4 GALNT1 antibody was raised using the N terminal of B4 ALNT1 corresponding to a region with amino acids APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

B4GALNT1 Blocking Peptide, catalog no. 33R-1441, is also available for use as a blocking control in assays to test for specificity of this B4GALNT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu B4GALNT1

Target: B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))

Andere Bezeichnung: B4GALNT1 (B4GALNT1 Produkte)

Synonyme: MGC53523 antikoerper, B4GALNT1 antikoerper, zgc:158609 antikoerper, GALGT antikoerper, GALNACT antikoerper, GalNAc-T antikoerper, SPG26 antikoerper, 4933429D13Rik antikoerper, Gal-NAc-T antikoerper, GalNAcT antikoerper, Galgt1 antikoerper, Ggm-2 antikoerper, Ggm2 antikoerper, beta-1,4-N-acetyl-galactosaminyl transferase 1 L homeolog antikoerper, beta-1,4-N-acetyl-galactosaminyl transferase 1a antikoerper, beta-1,4-N-acetyl-galactosaminyl transferase 1 antikoerper, Beta-1,4 N-acetylgalactosaminyltransferase 1 antikoerper, beta-1,4-N-acetyl-galactosaminyltransferase 1 antikoerper, b4galnt1.L antikoerper, b4galnt1a antikoerper, b4galnt1 antikoerper, b4gn1 antikoerper, B4GALNT1 antikoerper, B4galnt1 antikoerper

Hintergrund: GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids.

Molekulargewicht: 59 kDa (MW of target protein)