PI3 Antikörper
-
- Target Alle PI3 Antikörper anzeigen
- PI3 (Peptidase Inhibitor 3, Skin-Derived (PI3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PI3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAM
- Top Product
- Discover our top product PI3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PI3 Blocking Peptide, catalog no. 33R-4407, is also available for use as a blocking control in assays to test for specificity of this PI3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PI3 (Peptidase Inhibitor 3, Skin-Derived (PI3))
- Andere Bezeichnung
- PI3 (PI3 Produkte)
- Synonyme
- ESI antikoerper, SKALP antikoerper, WAP3 antikoerper, WFDC14 antikoerper, cementoin antikoerper, trappin-2 antikoerper, TRAPPIN-2 antikoerper, elafin antikoerper, peptidase inhibitor 3 antikoerper, peptidase inhibitor 3, skin-derived (SKALP) antikoerper, PI3 antikoerper
- Hintergrund
- PI3 is an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. PI3 contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. PI3 belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.
- Molekulargewicht
- 6 kDa (MW of target protein)
-