ST3GAL1 Antikörper (C-Term)
-
- Target Alle ST3GAL1 Antikörper anzeigen
- ST3GAL1 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 1 (ST3GAL1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ST3GAL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ST3 GAL1 antibody was raised against the C terminal of ST3 AL1
- Aufreinigung
- Affinity purified
- Immunogen
- ST3 GAL1 antibody was raised using the C terminal of ST3 AL1 corresponding to a region with amino acids YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN
- Top Product
- Discover our top product ST3GAL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ST3GAL1 Blocking Peptide, catalog no. 33R-10274, is also available for use as a blocking control in assays to test for specificity of this ST3GAL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST3GAL1 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 1 (ST3GAL1))
- Andere Bezeichnung
- ST3GAL1 (ST3GAL1 Produkte)
- Hintergrund
- ST3GAL1 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. It is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of ST3GAL1 protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-