ST3GAL1 Antikörper (C-Term)

Produktnummer ABIN635955

Produktdetails anti-ST3GAL1 Antikörper

Target: ST3GAL1 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 1 (ST3GAL1))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST3GAL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ST3 GAL1 antibody was raised against the C terminal of ST3 AL1

Aufreinigung: Affinity purified

Immunogen: ST3 GAL1 antibody was raised using the C terminal of ST3 AL1 corresponding to a region with amino acids YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST3GAL1 Blocking Peptide, catalog no. 33R-10274, is also available for use as a blocking control in assays to test for specificity of this ST3GAL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST3GAL1

Target: ST3GAL1 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 1 (ST3GAL1))

Andere Bezeichnung: ST3GAL1 (ST3GAL1 Produkte)

Synonyme: Gal-NAc6S antikoerper, SIAT4A antikoerper, SIATFL antikoerper, ST3GalA antikoerper, ST3GalA.1 antikoerper, ST3GalIA antikoerper, ST3GalIA,1 antikoerper, ST3O antikoerper, 5330418N22Rik antikoerper, AI467004 antikoerper, ST3GalI antikoerper, Siat4 antikoerper, Siat4a antikoerper, St3gal-1 antikoerper, ST3 beta-galactoside alpha-2,3-sialyltransferase 1 antikoerper, st3gal1 antikoerper, ST3GAL1 antikoerper, St3gal1 antikoerper

Hintergrund: ST3GAL1 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. It is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of ST3GAL1 protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process