TMEM187 Antikörper (Middle Region)

Produktnummer ABIN635956

Produktdetails anti-TMEM187 Antikörper

Target: TMEM187 (Transmembrane Protein 187 (TMEM187))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM187 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM187 antibody was raised against the middle region of TMEM187

Aufreinigung: Affinity purified

Immunogen: TMEM187 antibody was raised using the middle region of TMEM187 corresponding to a region with amino acids ECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM187 Blocking Peptide, catalog no. 33R-2300, is also available for use as a blocking control in assays to test for specificity of this TMEM187 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM187 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM187

Target: TMEM187 (Transmembrane Protein 187 (TMEM187))

Andere Bezeichnung: TMEM187 (TMEM187 Produkte)

Synonyme: si:dkey-9i23.7 antikoerper, TMEM187 antikoerper, CXorf12 antikoerper, DXS9878E antikoerper, ITBA1 antikoerper, transmembrane protein 187 antikoerper, Transmembrane protein 187 antikoerper, LOC465934 antikoerper, TMEM187 antikoerper, tmem187 antikoerper, tm187 antikoerper

Hintergrund: TMEM187 is a multi-pass membrane protein. The exact function of TMEM187 remains unknown.

Molekulargewicht: 29 kDa (MW of target protein)