Oncostatin M Receptor Antikörper (N-Term)
-
- Target Alle Oncostatin M Receptor (OSMR) Antikörper anzeigen
- Oncostatin M Receptor (OSMR)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Oncostatin M Receptor Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OSMR antibody was raised against the N terminal of OSMR
- Aufreinigung
- Affinity purified
- Immunogen
- OSMR antibody was raised using the N terminal of OSMR corresponding to a region with amino acids YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ
- Top Product
- Discover our top product OSMR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OSMR Blocking Peptide, catalog no. 33R-10217, is also available for use as a blocking control in assays to test for specificity of this OSMR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSMR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Oncostatin M Receptor (OSMR)
- Andere Bezeichnung
- OSMR (OSMR Produkte)
- Hintergrund
- Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells.
- Molekulargewicht
- 110 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, Growth Factor Binding
-