TMPRSS11D Antikörper (Middle Region)
-
- Target Alle TMPRSS11D Antikörper anzeigen
- TMPRSS11D (Transmembrane Protease, serine 11D (TMPRSS11D))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMPRSS11D Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMPRSS11 D antibody was raised against the middle region of TMPRSS11
- Aufreinigung
- Affinity purified
- Immunogen
- TMPRSS11 D antibody was raised using the middle region of TMPRSS11 corresponding to a region with amino acids IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC
- Top Product
- Discover our top product TMPRSS11D Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMPRSS11D Blocking Peptide, catalog no. 33R-3987, is also available for use as a blocking control in assays to test for specificity of this TMPRSS11D antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMPRSS11D (Transmembrane Protease, serine 11D (TMPRSS11D))
- Andere Bezeichnung
- TMPRSS11D (TMPRSS11D Produkte)
- Synonyme
- HAT antikoerper, AST antikoerper, AsP antikoerper, BC020151 antikoerper, Asp antikoerper, Tmprss11d antikoerper, transmembrane protease, serine 11D antikoerper, transmembrane protease, serine 11d antikoerper, transmembrane protease serine 11D antikoerper, TMPRSS11D antikoerper, Tmprss11d antikoerper, LOC100720850 antikoerper
- Hintergrund
- TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.
- Molekulargewicht
- 46 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Regulation of Carbohydrate Metabolic Process
-