HAS3 Antikörper (N-Term)

Produktnummer ABIN635962

Produktdetails anti-HAS3 Antikörper

Target: HAS3 (Hyaluronan Synthase 3 (HAS3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAS3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HAS3 antibody was raised against the N terminal of HAS3

Aufreinigung: Affinity purified

Immunogen: HAS3 antibody was raised using the N terminal of HAS3 corresponding to a region with amino acids GQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAS3 Blocking Peptide, catalog no. 33R-3489, is also available for use as a blocking control in assays to test for specificity of this HAS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAS3

Target: HAS3 (Hyaluronan Synthase 3 (HAS3))

Andere Bezeichnung: HAS3 (HAS3 Produkte)

Synonyme: HAS3 antikoerper, dg42III antikoerper, xx:af190743gs1 antikoerper, xx:af190743gs2 antikoerper, xhas3 antikoerper, CHAS3 antikoerper, hyaluronan synthase 3 antikoerper, hyaluronan synthase 3 S homeolog antikoerper, HAS3 antikoerper, has3 antikoerper, Has3 antikoerper, has3.S antikoerper

Hintergrund: HAS3 is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process