ST3GAL4 Antikörper (Middle Region)

Produktnummer ABIN635964

Produktdetails anti-ST3GAL4 Antikörper

Target: ST3GAL4 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST3GAL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ST3 GAL4 antibody was raised against the middle region of ST3 AL4

Aufreinigung: Affinity purified

Immunogen: ST3 GAL4 antibody was raised using the middle region of ST3 AL4 corresponding to a region with amino acids FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST3GAL4 Blocking Peptide, catalog no. 33R-2869, is also available for use as a blocking control in assays to test for specificity of this ST3GAL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST3GAL4

Target: ST3GAL4 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4))

Andere Bezeichnung: ST3GAL4 (ST3GAL4 Produkte)

Synonyme: siat4c antikoerper, im:7151092 antikoerper, zgc:158162 antikoerper, SIAT4C antikoerper, CGS23 antikoerper, NANTA3 antikoerper, SAT3 antikoerper, SIAT4 antikoerper, ST3GalIV antikoerper, STZ antikoerper, ST3GAL-IV antikoerper, Siat4c antikoerper, ST3 beta-galactoside alpha-2,3-sialyltransferase 4 antikoerper, ST3 beta-galactoside alpha-2,3-sialyltransferase 4 L homeolog antikoerper, st3gal4 antikoerper, ST3GAL4 antikoerper, St3gal4 antikoerper, st3gal4.L antikoerper

Hintergrund: Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase, ST6GAL1.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process