ST3GAL3 Antikörper (N-Term)

Produktnummer ABIN635965

Produktdetails anti-ST3GAL3 Antikörper

Target: ST3GAL3 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST3GAL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ST3 GAL3 antibody was raised against the N terminal of ST3 AL3

Aufreinigung: Affinity purified

Immunogen: ST3 GAL3 antibody was raised using the N terminal of ST3 AL3 corresponding to a region with amino acids MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST3GAL3 Blocking Peptide, catalog no. 33R-6531, is also available for use as a blocking control in assays to test for specificity of this ST3GAL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST3GAL3

Target: ST3GAL3 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3))

Andere Bezeichnung: ST3GAL3 (ST3GAL3 Produkte)

Synonyme: siat6 antikoerper, st3Gal-III antikoerper, st3galii antikoerper, st3galiii antikoerper, st3n antikoerper, SIAT6 antikoerper, EIEE15 antikoerper, MRT12 antikoerper, ST3GALII antikoerper, ST3GalIII antikoerper, ST3N antikoerper, ST3GAL-III antikoerper, Siat3 antikoerper, Siat6 antikoerper, ST3GALIII antikoerper, st3gal3 antikoerper, zgc:63978 antikoerper, ST3 beta-galactoside alpha-2,3-sialyltransferase 3 S homeolog antikoerper, ST3 beta-galactoside alpha-2,3-sialyltransferase 3 antikoerper, ST3 beta-galactoside alpha-2,3-sialyltransferase 3a antikoerper, st3gal3.S antikoerper, ST3GAL3 antikoerper, St3gal3 antikoerper, st3gal3a antikoerper

Hintergrund: ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process