TMED1 Antikörper (Middle Region)
-
- Target Alle TMED1 Antikörper anzeigen
- TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMED1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMED1 antibody was raised against the middle region of TMED1
- Aufreinigung
- Affinity purified
- Immunogen
- TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF
- Top Product
- Discover our top product TMED1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMED1 Blocking Peptide, catalog no. 33R-3095, is also available for use as a blocking control in assays to test for specificity of this TMED1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))
- Andere Bezeichnung
- TMED1 (TMED1 Produkte)
- Synonyme
- Il1rl1l antikoerper, Ly84l antikoerper, St2l antikoerper, IL1RL1LG antikoerper, Tp24 antikoerper, tmed1 antikoerper, zgc:92038 antikoerper, zgc:158680 antikoerper, transmembrane p24 trafficking protein 1 antikoerper, transmembrane p24 trafficking protein 1a antikoerper, transmembrane p24 trafficking protein 1b antikoerper, Tmed1 antikoerper, TMED1 antikoerper, tmed1a antikoerper, tmed1b antikoerper
- Hintergrund
- TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.
- Molekulargewicht
- 23 kDa (MW of target protein)
-