TMEM115 Antikörper (N-Term)
-
- Target Alle TMEM115 Antikörper anzeigen
- TMEM115 (Transmembrane Protein 115 (TMEM115))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM115 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMEM115 antibody was raised against the N terminal of TMEM115
- Aufreinigung
- Affinity purified
- Immunogen
- TMEM115 antibody was raised using the N terminal of TMEM115 corresponding to a region with amino acids LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV
- Top Product
- Discover our top product TMEM115 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMEM115 Blocking Peptide, catalog no. 33R-5190, is also available for use as a blocking control in assays to test for specificity of this TMEM115 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM115 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM115 (Transmembrane Protein 115 (TMEM115))
- Andere Bezeichnung
- TMEM115 (TMEM115 Produkte)
- Synonyme
- TMEM115 antikoerper, PL6 antikoerper, wu:fc43c03 antikoerper, wu:fd18h12 antikoerper, zgc:114074 antikoerper, C78915 antikoerper, Pl6 antikoerper, Pp6 antikoerper, RGD1310540 antikoerper, transmembrane protein 115 antikoerper, transmembrane protein 115 S homeolog antikoerper, TMEM115 antikoerper, CpipJ_CPIJ001136 antikoerper, CpipJ_CPIJ014350 antikoerper, MCYG_03262 antikoerper, MGYG_00421 antikoerper, tmem115.S antikoerper, tmem115 antikoerper, Tmem115 antikoerper
- Hintergrund
- The specific function of TMEM115 is not yet known.
- Molekulargewicht
- 38 kDa (MW of target protein)
-