NOX1 Antikörper (C-Term)
-
- Target Alle NOX1 Antikörper anzeigen
- NOX1 (NADPH Oxidase 1 (NOX1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NOX1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NOX1 antibody was raised against the C terminal of NOX1
- Aufreinigung
- Affinity purified
- Immunogen
- NOX1 antibody was raised using the C terminal of NOX1 corresponding to a region with amino acids STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
- Top Product
- Discover our top product NOX1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NOX1 Blocking Peptide, catalog no. 33R-8868, is also available for use as a blocking control in assays to test for specificity of this NOX1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOX1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOX1 (NADPH Oxidase 1 (NOX1))
- Andere Bezeichnung
- NOX1 (NOX1 Produkte)
- Synonyme
- GP91-2 antikoerper, MOX1 antikoerper, NOH-1 antikoerper, NOH1 antikoerper, NOX1a antikoerper, NOX1alpha antikoerper, Nox-1 antikoerper, Nox1 antikoerper, NADPH oxidase 1 antikoerper, NOX1 antikoerper, Nox1 antikoerper, nox1 antikoerper
- Hintergrund
- Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox.
- Molekulargewicht
- 65 kDa (MW of target protein)
- Pathways
- Regulation of Systemic Arterial Blood Pressure by Hormones, Proton Transport
-