ICMT Antikörper (Middle Region)

Produktnummer ABIN635975

Produktdetails anti-ICMT Antikörper

Target: ICMT (Isoprenylcysteine Carboxyl Methyltransferase (ICMT))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ICMT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ICMT antibody was raised against the middle region of ICMT

Aufreinigung: Affinity purified

Immunogen: ICMT antibody was raised using the middle region of ICMT corresponding to a region with amino acids GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ICMT Blocking Peptide, catalog no. 33R-3574, is also available for use as a blocking control in assays to test for specificity of this ICMT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICMT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ICMT

Target: ICMT (Isoprenylcysteine Carboxyl Methyltransferase (ICMT))

Andere Bezeichnung: ICMT (ICMT Produkte)

Synonyme: HSTE14 antikoerper, MST098 antikoerper, MSTP098 antikoerper, PCCMT antikoerper, PCMT antikoerper, PPMT antikoerper, 1700008E11Rik antikoerper, C80758 antikoerper, Gm13095 antikoerper, OTTMUSG00000010406 antikoerper, STE14 antikoerper, pcCMT antikoerper, fcmt antikoerper, im:6895697 antikoerper, zgc:110258 antikoerper, isoprenylcysteine carboxyl methyltransferase antikoerper, cobalt-zinc-cadmium resistance protein antikoerper, Isoprenylcysteine carboxyl methyltransferase antikoerper, isoprenylcysteine carboxylmethyltransferase family protein antikoerper, isoprenylcysteine carboxyl methyltransferase S homeolog antikoerper, ICMT antikoerper, Icmt antikoerper, icmt antikoerper, Bcen_5417 antikoerper, Acid_0983 antikoerper, Bcenmc03_4825 antikoerper, RPIC_RS08670 antikoerper, Mesil_1887 antikoerper, Slip_1333 antikoerper, Deba_2487 antikoerper, Bresu_2161 antikoerper, MPET_RS04760 antikoerper, MPET_RS08305 antikoerper, Saut_0066 antikoerper, Intca_3523 antikoerper, Deima_2891 antikoerper, Despr_1203 antikoerper, Deipr_0831 antikoerper, Theth_0229 antikoerper, icmt.S antikoerper

Hintergrund: ICMT is the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined.

Molekulargewicht: 32 kDa (MW of target protein)