TMX2 Antikörper (Middle Region)
-
- Target Alle TMX2 Antikörper anzeigen
- TMX2 (Thioredoxin-Related Transmembrane Protein 2 (TMX2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMX2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TXNDC14 antibody was raised against the middle region of TXNDC14
- Aufreinigung
- Affinity purified
- Immunogen
- TXNDC14 antibody was raised using the middle region of TXNDC14 corresponding to a region with amino acids IRMGLLYITLCIVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWI
- Top Product
- Discover our top product TMX2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TXNDC14 Blocking Peptide, catalog no. 33R-4138, is also available for use as a blocking control in assays to test for specificity of this TXNDC14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMX2 (Thioredoxin-Related Transmembrane Protein 2 (TMX2))
- Andere Bezeichnung
- TXNDC14 (TMX2 Produkte)
- Synonyme
- PDIA12 antikoerper, PIG26 antikoerper, TXNDC14 antikoerper, 2310042M24Rik antikoerper, AA589631 antikoerper, Txndc14 antikoerper, tmx2 antikoerper, txndc14 antikoerper, wu:fb73h06 antikoerper, zgc:86830 antikoerper, pig26 antikoerper, cgi-31 antikoerper, MGC79568 antikoerper, DKFZp469G2332 antikoerper, im:7138651 antikoerper, zgc:172264 antikoerper, thioredoxin related transmembrane protein 2 antikoerper, thioredoxin-related transmembrane protein 2 antikoerper, thioredoxin-related transmembrane protein 2b antikoerper, thioredoxin domain containing 14 antikoerper, thioredoxin related transmembrane protein 2 S homeolog antikoerper, thioredoxin-related transmembrane protein 2a antikoerper, TMX2 antikoerper, Tmx2 antikoerper, tmx2b antikoerper, tmx2 antikoerper, CpipJ_CPIJ000873 antikoerper, tmx2.S antikoerper, tmx2a antikoerper
- Hintergrund
- The function of TXNDC14 has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 34 kDa (MW of target protein)
-