A4GNT Antikörper (N-Term)
-
- Target Alle A4GNT Antikörper anzeigen
- A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser A4GNT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- A4 GNT antibody was raised against the N terminal of A4 NT
- Aufreinigung
- Affinity purified
- Immunogen
- A4 GNT antibody was raised using the N terminal of A4 NT corresponding to a region with amino acids LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME
- Top Product
- Discover our top product A4GNT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
A4GNT Blocking Peptide, catalog no. 33R-5167, is also available for use as a blocking control in assays to test for specificity of this A4GNT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 NT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))
- Andere Bezeichnung
- A4GNT (A4GNT Produkte)
- Synonyme
- A4GNT antikoerper, a4gnt antikoerper, MGC116495 antikoerper, ALPHA4GNT antikoerper, alpha4GnT antikoerper, AV080780 antikoerper, Alpha4gnt antikoerper, Gm798 antikoerper, alpha-1,4-N-acetylglucosaminyltransferase antikoerper, alpha-1,4-N-acetylglucosaminyltransferase L homeolog antikoerper, A4GNT antikoerper, a4gnt antikoerper, a4gnt.L antikoerper, A4gnt antikoerper
- Hintergrund
- A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated with the Golgi apparatus membrane.
- Molekulargewicht
- 39 kDa (MW of target protein)
-