A4GNT Antikörper (C-Term)

Produktnummer ABIN635982

Produktdetails anti-A4GNT Antikörper

Target: A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser A4GNT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: A4 GNT antibody was raised against the C terminal of A4 NT

Aufreinigung: Affinity purified

Immunogen: A4 GNT antibody was raised using the C terminal of A4 NT corresponding to a region with amino acids NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

A4GNT Blocking Peptide, catalog no. 33R-6732, is also available for use as a blocking control in assays to test for specificity of this A4GNT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 NT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu A4GNT

Target: A4GNT (alpha-1,4-N-Acetylglucosaminyltransferase (A4GNT))

Andere Bezeichnung: A4GNT (A4GNT Produkte)

Synonyme: A4GNT antikoerper, a4gnt antikoerper, MGC116495 antikoerper, ALPHA4GNT antikoerper, alpha4GnT antikoerper, AV080780 antikoerper, Alpha4gnt antikoerper, Gm798 antikoerper, alpha-1,4-N-acetylglucosaminyltransferase antikoerper, alpha-1,4-N-acetylglucosaminyltransferase L homeolog antikoerper, A4GNT antikoerper, a4gnt antikoerper, a4gnt.L antikoerper, A4gnt antikoerper

Hintergrund: A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated with the Golgi apparatus membrane.

Molekulargewicht: 39 kDa (MW of target protein)