TMEM9 Antikörper (C-Term)

Produktnummer ABIN635985

Produktdetails anti-TMEM9 Antikörper

Target: TMEM9 (Transmembrane Protein 9 (TMEM9))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM9 antibody was raised against the C terminal of TMEM9

Aufreinigung: Affinity purified

Immunogen: TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM9 Blocking Peptide, catalog no. 33R-1863, is also available for use as a blocking control in assays to test for specificity of this TMEM9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM9

Target: TMEM9 (Transmembrane Protein 9 (TMEM9))

Andere Bezeichnung: TMEM9 (TMEM9 Produkte)

Synonyme: fi33g11 antikoerper, wu:fi33g11 antikoerper, zgc:55432 antikoerper, TMEM9A antikoerper, 1500015G18Rik antikoerper, AW545782 antikoerper, transmembrane protein 9 antikoerper, tmem9 antikoerper, TMEM9 antikoerper, Tmem9 antikoerper

Hintergrund: TMEM9 belongs to the TMEM9 family. It may be involved in intracellular transport.

Molekulargewicht: 20 kDa (MW of target protein)