QPCTL Antikörper (Middle Region)

Produktnummer ABIN635992

Produktdetails anti-QPCTL Antikörper

Target: QPCTL (Glutaminyl-Peptide Cyclotransferase-Like (QPCTL))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser QPCTL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: QPCTL antibody was raised against the middle region of QPCTL

Aufreinigung: Affinity purified

Immunogen: QPCTL antibody was raised using the middle region of QPCTL corresponding to a region with amino acids QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

QPCTL Blocking Peptide, catalog no. 33R-7631, is also available for use as a blocking control in assays to test for specificity of this QPCTL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QPCTL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu QPCTL

Target: QPCTL (Glutaminyl-Peptide Cyclotransferase-Like (QPCTL))

Andere Bezeichnung: QPCTL (QPCTL Produkte)

Synonyme: fb71g05 antikoerper, si:dkey-149j18.2 antikoerper, wu:fb71g05 antikoerper, si:ch211-191j22.6 antikoerper, gQC antikoerper, 1810019P04Rik antikoerper, BB101812 antikoerper, RGD1308128 antikoerper, glutaminyl-peptide cyclotransferase-like antikoerper, glutaminyl-peptide cyclotransferase like antikoerper, glutaminyl-peptide cyclotransferase-like a antikoerper, glutaminyl-peptide cyclotransferase-like b antikoerper, glutaminyl-peptide cyclotransferase antikoerper, LOC411943 antikoerper, QPCTL antikoerper, qpctla antikoerper, qpctlb antikoerper, LOC100163689 antikoerper, qpctl antikoerper, Qpctl antikoerper

Hintergrund: QPCTL is a single-pass membrane proteinPotential. It belongs to the glutaminyl-peptide cyclotransferase family. The exact function of QPCTL remains unknown.

Molekulargewicht: 43 kDa (MW of target protein)