TMCO3 Antikörper (N-Term)
-
- Target Alle TMCO3 Antikörper anzeigen
- TMCO3 (Transmembrane and Coiled-Coil Domains 3 (TMCO3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMCO3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMCO3 antibody was raised against the N terminal of TMCO3
- Aufreinigung
- Affinity purified
- Immunogen
- TMCO3 antibody was raised using the N terminal of TMCO3 corresponding to a region with amino acids KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRAL
- Top Product
- Discover our top product TMCO3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMCO3 Blocking Peptide, catalog no. 33R-4672, is also available for use as a blocking control in assays to test for specificity of this TMCO3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCO3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMCO3 (Transmembrane and Coiled-Coil Domains 3 (TMCO3))
- Andere Bezeichnung
- TMCO3 (TMCO3 Produkte)
- Hintergrund
- TMCO3 belongs to the monovalent cation:proton antiporter 2 (CPA2) transporter family. It is a multi-pass membrane protein. TMCO3 is a probable Na(+)/H(+) antiporter.
- Molekulargewicht
- 75 kDa (MW of target protein)
- Pathways
- Proton Transport
-