TMTC2 Antikörper (N-Term)

Produktnummer ABIN635998

Produktdetails anti-TMTC2 Antikörper

Target: TMTC2 (Transmembrane and Tetratricopeptide Repeat Containing 2 (TMTC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMTC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMTC2 antibody was raised against the N terminal of TMTC2

Aufreinigung: Affinity purified

Immunogen: TMTC2 antibody was raised using the N terminal of TMTC2 corresponding to a region with amino acids SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMTC2 Blocking Peptide, catalog no. 33R-8658, is also available for use as a blocking control in assays to test for specificity of this TMTC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMTC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMTC2

Target: TMTC2 (Transmembrane and Tetratricopeptide Repeat Containing 2 (TMTC2))

Andere Bezeichnung: TMTC2 (TMTC2 Produkte)

Synonyme: si:ch211-161n3.1 antikoerper, IBDBP1 antikoerper, 8430438D04Rik antikoerper, D330034A10Rik antikoerper, RGD1309848 antikoerper, transmembrane and tetratricopeptide repeat containing 2a antikoerper, transmembrane and tetratricopeptide repeat containing 2 S homeolog antikoerper, transmembrane and tetratricopeptide repeat containing 2 antikoerper, tmtc2a antikoerper, tmtc2.S antikoerper, TMTC2 antikoerper, Tmtc2 antikoerper

Hintergrund: TMTC2 is a multi-pass membrane protein, which contains 10 TPR repeats.It belongs to the TMTC family. The exact function of TMTC2 remains unknown.

Molekulargewicht: 94 kDa (MW of target protein)