SCUBE2 Antikörper (C-Term)
-
- Target Alle SCUBE2 Produkte
- SCUBE2 (Signal Peptide, CUB Domain, EGF-Like 2 (SCUBE2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SCUBE2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SCUBE2 antibody was raised against the C terminal of SCUBE2
- Aufreinigung
- Affinity purified
- Immunogen
- SCUBE2 antibody was raised using the C terminal of SCUBE2 corresponding to a region with amino acids KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SCUBE2 Blocking Peptide, catalog no. 33R-4686, is also available for use as a blocking control in assays to test for specificity of this SCUBE2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCUBE2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCUBE2 (Signal Peptide, CUB Domain, EGF-Like 2 (SCUBE2))
- Andere Bezeichnung
- SCUBE2 (SCUBE2 Produkte)
- Hintergrund
- SCUBE2 contains 1 CUB domain and 9 EGF-like domains. The function of the SCUBE2 protein remains unknown.
- Molekulargewicht
- 110 kDa (MW of target protein)
-