SCUBE2 Antikörper (C-Term)

Produktnummer ABIN636003

Produktdetails anti-SCUBE2 Antikörper

Target: SCUBE2 (Signal Peptide, CUB Domain, EGF-Like 2 (SCUBE2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCUBE2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SCUBE2 antibody was raised against the C terminal of SCUBE2

Aufreinigung: Affinity purified

Immunogen: SCUBE2 antibody was raised using the C terminal of SCUBE2 corresponding to a region with amino acids KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCUBE2 Blocking Peptide, catalog no. 33R-4686, is also available for use as a blocking control in assays to test for specificity of this SCUBE2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCUBE2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCUBE2

Target: SCUBE2 (Signal Peptide, CUB Domain, EGF-Like 2 (SCUBE2))

Andere Bezeichnung: SCUBE2 (SCUBE2 Produkte)

Synonyme: CEGB1 antikoerper, CEGF1 antikoerper, CEGP1 antikoerper, 4932442O19Rik antikoerper, Cegf1 antikoerper, Cegp1 antikoerper, RGD1563998 antikoerper, Scube2-ps1 antikoerper, wu:fc27f08 antikoerper, you antikoerper, signal peptide, CUB domain and EGF like domain containing 2 antikoerper, signal peptide, CUB domain, EGF-like 2 antikoerper, SCUBE2 antikoerper, Scube2 antikoerper, scube2 antikoerper

Hintergrund: SCUBE2 contains 1 CUB domain and 9 EGF-like domains. The function of the SCUBE2 protein remains unknown.

Molekulargewicht: 110 kDa (MW of target protein)