DNAJC1 Antikörper
-
- Target Alle DNAJC1 Antikörper anzeigen
- DNAJC1 (DnaJ (Hsp40) Homolog, Subfamily C, Member 1 (DNAJC1))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DNAJC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DNAJC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS
- Top Product
- Discover our top product DNAJC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DNAJC1 Blocking Peptide, catalog no. 33R-2528, is also available for use as a blocking control in assays to test for specificity of this DNAJC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAJC1 (DnaJ (Hsp40) Homolog, Subfamily C, Member 1 (DNAJC1))
- Andere Bezeichnung
- DNAJC1 (DNAJC1 Produkte)
- Synonyme
- dnajc1l antikoerper, zgc:152779 antikoerper, DNAJL1 antikoerper, ERdj1 antikoerper, HTJ1 antikoerper, MTJ1 antikoerper, 4733401K02Rik antikoerper, AA960110 antikoerper, D230036H06Rik antikoerper, Dnajl1 antikoerper, ERj1p antikoerper, DnaJ heat shock protein family (Hsp40) member C1 antikoerper, DnaJ (Hsp40) homolog, subfamily C, member 1 antikoerper, DnaJ heat shock protein family (Hsp40) member C1 S homeolog antikoerper, dnajc1 antikoerper, DNAJC1 antikoerper, Dnajc1 antikoerper, dnajc1.S antikoerper
- Hintergrund
- DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown.
- Molekulargewicht
- 64 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-