SRD5A3 Antikörper (N-Term)

Produktnummer ABIN636011

Produktdetails anti-SRD5A3 Antikörper

Target: SRD5A3 (Steroid 5 alpha-Reductase 3 (SRD5A3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRD5A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SRD5 A3 antibody was raised against the N terminal of SRD5 3

Aufreinigung: Affinity purified

Immunogen: SRD5 A3 antibody was raised using the N terminal of SRD5 3 corresponding to a region with amino acids GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SRD5A3 Blocking Peptide, catalog no. 33R-3408, is also available for use as a blocking control in assays to test for specificity of this SRD5A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRD0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRD5A3

Target: SRD5A3 (Steroid 5 alpha-Reductase 3 (SRD5A3))

Andere Bezeichnung: SRD5A3 (SRD5A3 Produkte)

Synonyme: CDG1P antikoerper, CDG1Q antikoerper, KRIZI antikoerper, SRD5A2L antikoerper, SRD5A2L1 antikoerper, 1110025P14Rik antikoerper, A430076C09 antikoerper, AV364670 antikoerper, AW987574 antikoerper, D730040M03Rik antikoerper, H5ar antikoerper, S5AR 3 antikoerper, Srd5a2l antikoerper, RGD1308828 antikoerper, SRD5alpha3 antikoerper, steroid 5 alpha-reductase 3 antikoerper, steroid 5 alpha-reductase 3 S homeolog antikoerper, SRD5A3 antikoerper, Srd5a3 antikoerper, srd5a3.S antikoerper

Hintergrund: SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT).

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis