MANEA Antikörper (Middle Region)

Produktnummer ABIN636012

Produktdetails anti-MANEA Antikörper

Target: MANEA (Mannosidase, Endo-alpha (MANEA))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MANEA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MANEA antibody was raised against the middle region of MANEA

Aufreinigung: Affinity purified

Immunogen: MANEA antibody was raised using the middle region of MANEA corresponding to a region with amino acids KVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MANEA Blocking Peptide, catalog no. 33R-4723, is also available for use as a blocking control in assays to test for specificity of this MANEA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MANEA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MANEA

Target: MANEA (Mannosidase, Endo-alpha (MANEA))

Andere Bezeichnung: MANEA (MANEA Produkte)

Synonyme: ENDO antikoerper, hEndo antikoerper, Enman antikoerper, 4932703L02Rik antikoerper, fi29h09 antikoerper, zgc:92825 antikoerper, wu:fi29h09 antikoerper, mannosidase endo-alpha antikoerper, mannosidase, endo-alpha antikoerper, MANEA antikoerper, Manea antikoerper, manea antikoerper

Hintergrund: N-glycosylation of proteins is initiated in the endoplasmic reticulum (ER) by the transfer of the preassembled oligosaccharide glucose-3-mannose-9-N-acetylglucosamine-2 from dolichyl pyrophosphate to acceptor sites on the target protein by an oligosaccharyltransferase complex.

Molekulargewicht: 54 kDa (MW of target protein)