UGT2A3 Antikörper (N-Term)

Produktnummer ABIN636014

Produktdetails anti-UGT2A3 Antikörper

Target: UGT2A3 (UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGT2A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGT2 A3 antibody was raised against the N terminal of µgT2 3

Aufreinigung: Affinity purified

Immunogen: UGT2 A3 antibody was raised using the N terminal of µgT2 3 corresponding to a region with amino acids NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGT2A3 Blocking Peptide, catalog no. 33R-6917, is also available for use as a blocking control in assays to test for specificity of this µgT2A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGT2A3

Target: UGT2A3 (UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3))

Andere Bezeichnung: UGT2A3 (UGT2A3 Produkte)

Synonyme: UGT2A1 antikoerper, zgc:112491 antikoerper, 2010321J07Rik antikoerper, RGD1308444 antikoerper, Ugt2a3 antikoerper, UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus antikoerper, UDP glucuronosyltransferase family 2 member A3 antikoerper, UDP glucuronosyltransferase family 2 member A1 complex locus antikoerper, UDP glucuronosyltransferase 2 family, polypeptide A3 antikoerper, UDP-glucuronosyltransferase 2A3 antikoerper, UDP-glucuronosyltransferase 2A3-like antikoerper, UGT2A1 antikoerper, UGT2A3 antikoerper, LOC100351592 antikoerper, LOC100359229 antikoerper, ugt2a3 antikoerper, LOC100596311 antikoerper, Ugt2a3 antikoerper, LOC100135631 antikoerper

Hintergrund: UGT2A3 is a single-pass type I membrane proteinPotential. It belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis