UXS1 Antikörper (Middle Region)

Produktnummer ABIN636016

Produktdetails anti-UXS1 Antikörper

Target: UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UXS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UXS1 antibody was raised against the middle region of UXS1

Aufreinigung: Affinity purified

Immunogen: UXS1 antibody was raised using the middle region of UXS1 corresponding to a region with amino acids LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UXS1 Blocking Peptide, catalog no. 33R-5205, is also available for use as a blocking control in assays to test for specificity of this UXS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UXS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UXS1

Target: UXS1 (UDP-Glucuronate Decarboxylase 1 (UXS1))

Andere Bezeichnung: UXS1 (UXS1 Produkte)

Synonyme: SDR6E1 antikoerper, UGD antikoerper, 1600025I13Rik antikoerper, AI451869 antikoerper, AI649125 antikoerper, AW550562 antikoerper, CHUNP6891 antikoerper, fj36b08 antikoerper, wu:fj36b08 antikoerper, zgc:91980 antikoerper, UDP-glucuronate decarboxylase 1 antikoerper, uxs1 antikoerper, UXS1 antikoerper, Ccan_02290 antikoerper, Uxs1 antikoerper

Hintergrund: UDP-glucuronate decarboxylase catalyzes the formation of UDP-xylose from UDP-glucuronate. UDP-xylose is then used to initiate glycosaminoglycan biosynthesis on the core protein of proteoglycans.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process