GLT8D2 Antikörper (C-Term)

Produktnummer ABIN636017

Produktdetails anti-GLT8D2 Antikörper

Target: GLT8D2 (Glycosyltransferase 8 Domain Containing 2 (GLT8D2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLT8D2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLT8 D2 antibody was raised against the C terminal of GLT8 2

Aufreinigung: Affinity purified

Immunogen: GLT8 D2 antibody was raised using the C terminal of GLT8 2 corresponding to a region with amino acids IRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLT8D2 Blocking Peptide, catalog no. 33R-4131, is also available for use as a blocking control in assays to test for specificity of this GLT8D2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLT0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLT8D2

Target: GLT8D2 (Glycosyltransferase 8 Domain Containing 2 (GLT8D2))

Andere Bezeichnung: GLT8D2 (GLT8D2 Produkte)

Synonyme: si:dkey-22l11.1 antikoerper, zgc:136873 antikoerper, 1110021D20Rik antikoerper, RGD1560432 antikoerper, glycosyltransferase 8 domain containing 2 antikoerper, GLT8D2 antikoerper, glt8d2 antikoerper, Glt8d2 antikoerper

Hintergrund: GLT8D2 belongs to the glycosyltransferase 8 family. The exact function of it remains unknown.

Molekulargewicht: 40 kDa (MW of target protein)