PGAP3 Antikörper (N-Term)
-
- Target Alle PGAP3 Antikörper anzeigen
- PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PGAP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PERLD1 antibody was raised against the N terminal of PERLD1
- Aufreinigung
- Affinity purified
- Immunogen
- PERLD1 antibody was raised using the N terminal of PERLD1 corresponding to a region with amino acids ECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLV
- Top Product
- Discover our top product PGAP3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PERLD1 Blocking Peptide, catalog no. 33R-2299, is also available for use as a blocking control in assays to test for specificity of this PERLD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PERLD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))
- Andere Bezeichnung
- PERLD1 (PGAP3 Produkte)
- Synonyme
- GB10206 antikoerper, AGLA546 antikoerper, CAB2 antikoerper, PER1 antikoerper, PERLD1 antikoerper, PP1498 antikoerper, D430035D22Rik antikoerper, Perld1 antikoerper, perld1 antikoerper, pgap3 antikoerper, post-GPI attachment to proteins factor 3 antikoerper, post-GPI attachment to proteins 3 antikoerper, post-GPI attachment to proteins 3 L homeolog antikoerper, LOC412085 antikoerper, PGAP3 antikoerper, Pgap3 antikoerper, pgap3.L antikoerper, pgap3 antikoerper
- Hintergrund
- PERLD1 is involved in the lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist in the generation of 2 saturated fatty chains at the sn-2 position of GPI-anchors proteins. It is required for phospholipase A2 activity that removes an acyl-chain at the sn-2 position of GPI-anchors during the remodeling of GPI.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-