GALNT13 Antikörper (N-Term)
-
- Target Alle GALNT13 Antikörper anzeigen
- GALNT13 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GALNT13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GALNT13 antibody was raised against the N terminal Of Galnt13
- Aufreinigung
- Affinity purified
- Immunogen
- GALNT13 antibody was raised using the N terminal Of Galnt13 corresponding to a region with amino acids CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI
- Top Product
- Discover our top product GALNT13 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GALNT13 Blocking Peptide, catalog no. 33R-1754, is also available for use as a blocking control in assays to test for specificity of this GALNT13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALNT13 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13))
- Andere Bezeichnung
- GALNT13 (GALNT13 Produkte)
- Hintergrund
- The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase family, which initiate O-linked glycosylation of mucins by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.
- Molekulargewicht
- 64 kDa (MW of target protein)
-