GALNT13 Antikörper (N-Term)

Produktnummer ABIN636022

Produktdetails anti-GALNT13 Antikörper

Target: GALNT13 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GALNT13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GALNT13 antibody was raised against the N terminal Of Galnt13

Aufreinigung: Affinity purified

Immunogen: GALNT13 antibody was raised using the N terminal Of Galnt13 corresponding to a region with amino acids CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALNT13 Blocking Peptide, catalog no. 33R-1754, is also available for use as a blocking control in assays to test for specificity of this GALNT13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GALNT13

Target: GALNT13 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 13 (GalNAc-T13) (GALNT13))

Andere Bezeichnung: GALNT13 (GALNT13 Produkte)

Synonyme: si:ch1073-215b15.1 antikoerper, A230002A12 antikoerper, A230020F20 antikoerper, BB182356 antikoerper, GalNAc-T13 antikoerper, H_NH0187G20.1 antikoerper, WUGSC:H_NH0187G20.1 antikoerper, T13 antikoerper, polypeptide N-acetylgalactosaminyltransferase 13 antikoerper, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 antikoerper, polypeptide N-acetylgalactosaminyltransferase 13 S homeolog antikoerper, GALNT13 antikoerper, galnt13 antikoerper, LOC100544871 antikoerper, Galnt13 antikoerper, galnt13.S antikoerper

Hintergrund: The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase family, which initiate O-linked glycosylation of mucins by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.

Molekulargewicht: 64 kDa (MW of target protein)