Aquaporin 10 Antikörper (C-Term)

Produktnummer ABIN636023

Produktdetails anti-Aquaporin 10 Antikörper

Target: Aquaporin 10 (AQP10)

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Aquaporin 10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Aquaporin 10 antibody was raised against the C terminal of AQP10

Aufreinigung: Affinity purified

Immunogen: Aquaporin 10 antibody was raised using the C terminal of AQP10 corresponding to a region with amino acids VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Aquaporin 10 Blocking Peptide, catalog no. 33R-9546, is also available for use as a blocking control in assays to test for specificity of this Aquaporin 10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AQP10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Aquaporin 10

Target: Aquaporin 10 (AQP10)

Andere Bezeichnung: Aquaporin 10 (AQP10 Produkte)

Synonyme: aqp10 antikoerper, zgc:92167 antikoerper, AQP10 antikoerper, AQPA_HUMAN antikoerper, aquaporin 10a antikoerper, aquaporin 10 antikoerper, similar to aquaporin 10 antikoerper, aqp10a antikoerper, AQP10 antikoerper, LOC686596 antikoerper

Hintergrund: AQP10 is a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. AQP10 was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.

Molekulargewicht: 32 kDa (MW of target protein)