HS3ST5 Antikörper
-
- Target Alle HS3ST5 Antikörper anzeigen
- HS3ST5 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 5 (HS3ST5))
-
Reaktivität
- Maus, Ratte, Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HS3ST5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- HS3 ST5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH
- Top Product
- Discover our top product HS3ST5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HS3ST5 Blocking Peptide, catalog no. 33R-8735, is also available for use as a blocking control in assays to test for specificity of this HS3ST5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HS3ST5 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 5 (HS3ST5))
- Andere Bezeichnung
- HS3ST5 (HS3ST5 Produkte)
- Hintergrund
- HS3ST5 is the rate limiting enzyme for synthesis of HSact. It performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site. HS3ST5 also generates GlcUA-GlcNS or IdoUA-GlcNS and IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-