HS3ST5 Antikörper

Produktnummer ABIN636027

Produktdetails anti-HS3ST5 Antikörper

Target: HS3ST5 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 5 (HS3ST5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HS3ST5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HS3 ST5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HS3ST5 Blocking Peptide, catalog no. 33R-8735, is also available for use as a blocking control in assays to test for specificity of this HS3ST5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HS3ST5

Target: HS3ST5 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 5 (HS3ST5))

Andere Bezeichnung: HS3ST5 (HS3ST5 Produkte)

Synonyme: 3-OST-5 antikoerper, 3OST5 antikoerper, HS3OST5 antikoerper, NBLA04021 antikoerper, D930005L05Rik antikoerper, Gm1151 antikoerper, Hs3ost5 antikoerper, HS3ST6 antikoerper, HS3ST5 antikoerper, heparan sulfate-glucosamine 3-sulfotransferase 5 antikoerper, heparan sulfate (glucosamine) 3-O-sulfotransferase 5 antikoerper, HS3ST5 antikoerper, Hs3st5 antikoerper, hs3st5 antikoerper

Hintergrund: HS3ST5 is the rate limiting enzyme for synthesis of HSact. It performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site. HS3ST5 also generates GlcUA-GlcNS or IdoUA-GlcNS and IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process