LAMP3 Antikörper (N-Term)
-
- Target Alle LAMP3 Antikörper anzeigen
- LAMP3 (Lysosomal-Associated Membrane Protein 3 (LAMP3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LAMP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LAMP3 antibody was raised against the N terminal of LAMP3
- Aufreinigung
- Affinity purified
- Immunogen
- LAMP3 antibody was raised using the N terminal of LAMP3 corresponding to a region with amino acids YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT
- Top Product
- Discover our top product LAMP3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LAMP3 Blocking Peptide, catalog no. 33R-10246, is also available for use as a blocking control in assays to test for specificity of this LAMP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMP3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LAMP3 (Lysosomal-Associated Membrane Protein 3 (LAMP3))
- Andere Bezeichnung
- LAMP3 (LAMP3 Produkte)
- Hintergrund
- LAMP3 might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer.
- Molekulargewicht
- 44 kDa (MW of target protein)
-