LAMP3 Antikörper (N-Term)

Produktnummer ABIN636028

Produktdetails anti-LAMP3 Antikörper

Target: LAMP3 (Lysosomal-Associated Membrane Protein 3 (LAMP3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LAMP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LAMP3 antibody was raised against the N terminal of LAMP3

Aufreinigung: Affinity purified

Immunogen: LAMP3 antibody was raised using the N terminal of LAMP3 corresponding to a region with amino acids YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LAMP3 Blocking Peptide, catalog no. 33R-10246, is also available for use as a blocking control in assays to test for specificity of this LAMP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LAMP3

Target: LAMP3 (Lysosomal-Associated Membrane Protein 3 (LAMP3))

Andere Bezeichnung: LAMP3 (LAMP3 Produkte)

Synonyme: DC-LAMP antikoerper, CD208 antikoerper, DC LAMP antikoerper, DCLAMP antikoerper, LAMP antikoerper, LAMP-3 antikoerper, TSC403 antikoerper, 1200002D17Rik antikoerper, Cd208 antikoerper, lysosomal associated membrane protein 3 antikoerper, lysosomal-associated membrane protein 3 antikoerper, LAMP3 antikoerper, Lamp3 antikoerper

Hintergrund: LAMP3 might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer.

Molekulargewicht: 44 kDa (MW of target protein)