B4GALNT3 Antikörper (N-Term)

Produktnummer ABIN636034

Produktdetails anti-B4GALNT3 Antikörper

Target: B4GALNT3 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 3 (B4GALNT3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser B4GALNT3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: B4 GALNT3 antibody was raised against the N terminal of B4 ALNT3

Aufreinigung: Affinity purified

Immunogen: B4 GALNT3 antibody was raised using the N terminal of B4 ALNT3 corresponding to a region with amino acids NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

B4GALNT3 Blocking Peptide, catalog no. 33R-6666, is also available for use as a blocking control in assays to test for specificity of this B4GALNT3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu B4GALNT3

Target: B4GALNT3 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 3 (B4GALNT3))

Andere Bezeichnung: B4GALNT3 (B4GALNT3 Produkte)

Synonyme: RGD1561056 antikoerper, AB114826 antikoerper, B4GalNAcT3 antikoerper, C330047A21 antikoerper, beta-1,4-N-acetyl-galactosaminyltransferase 3 antikoerper, beta-1,4-N-acetyl-galactosaminyl transferase 3 antikoerper, B4GALNT3 antikoerper, B4galnt3 antikoerper

Hintergrund: B4GALNT3 transfers N-acetylgalactosamine (GalNAc) onto glucosyl residues to form N,N-prime-diacetyllactosediamine (LacdiNAc, or LDN), a unique terminal structure of cell surface N-glycans. It mediates the N,N'-diacetyllactosediamine formation on gastric mucosa.

Molekulargewicht: 115 kDa (MW of target protein)