B4GALNT3 Antikörper (N-Term)
-
- Target Alle B4GALNT3 Produkte
- B4GALNT3 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 3 (B4GALNT3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser B4GALNT3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- B4 GALNT3 antibody was raised against the N terminal of B4 ALNT3
- Aufreinigung
- Affinity purified
- Immunogen
- B4 GALNT3 antibody was raised using the N terminal of B4 ALNT3 corresponding to a region with amino acids NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
B4GALNT3 Blocking Peptide, catalog no. 33R-6666, is also available for use as a blocking control in assays to test for specificity of this B4GALNT3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B4GALNT3 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 3 (B4GALNT3))
- Andere Bezeichnung
- B4GALNT3 (B4GALNT3 Produkte)
- Hintergrund
- B4GALNT3 transfers N-acetylgalactosamine (GalNAc) onto glucosyl residues to form N,N-prime-diacetyllactosediamine (LacdiNAc, or LDN), a unique terminal structure of cell surface N-glycans. It mediates the N,N'-diacetyllactosediamine formation on gastric mucosa.
- Molekulargewicht
- 115 kDa (MW of target protein)
-