RDH10 Antikörper
-
- Target Alle RDH10 Antikörper anzeigen
- RDH10 (Retinol Dehydrogenase 10 (All-Trans) (RDH10))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RDH10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RDH10 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG
- Top Product
- Discover our top product RDH10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RDH10 Blocking Peptide, catalog no. 33R-7732, is also available for use as a blocking control in assays to test for specificity of this RDH10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RDH10 (Retinol Dehydrogenase 10 (All-Trans) (RDH10))
- Andere Bezeichnung
- RDH10 (RDH10 Produkte)
- Synonyme
- cb804 antikoerper, rdh10 antikoerper, SDR16C4 antikoerper, 3110069K09Rik antikoerper, 4921506A21Rik antikoerper, AI875664 antikoerper, AW549993 antikoerper, D1Ertd762e antikoerper, m366Asp antikoerper, retinol dehydrogenase 10b antikoerper, retinol dehydrogenase 10 antikoerper, retinol dehydrogenase 10 (all-trans) antikoerper, rdh10b antikoerper, MCYG_00691 antikoerper, RDH10 antikoerper, Rdh10 antikoerper
- Hintergrund
- RDH10 is a retinol dehydrogenase with a clear preference for NADP. RDH10 converts all-trans-retinol to all-trans-retinal. RDH10 has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle.
- Molekulargewicht
- 38 kDa (MW of target protein)
-