GPR56 Antikörper (N-Term)

Produktnummer ABIN636036

Produktdetails anti-GPR56 Antikörper

Target: GPR56 (G Protein-Coupled Receptor 56 (GPR56))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPR56 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GPR56 antibody was raised against the N terminal of GPR56

Aufreinigung: Affinity purified

Immunogen: GPR56 antibody was raised using the N terminal of GPR56 corresponding to a region with amino acids MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPR56 Blocking Peptide, catalog no. 33R-5594, is also available for use as a blocking control in assays to test for specificity of this GPR56 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR56 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPR56

Target: GPR56 (G Protein-Coupled Receptor 56 (GPR56))

Andere Bezeichnung: GPR56 (GPR56 Produkte)

Synonyme: fc49b10 antikoerper, wu:fc49b10 antikoerper, BFPP antikoerper, TM7LN4 antikoerper, TM7XN1 antikoerper, Cyt28 antikoerper, GPR56 antikoerper, adhesion G protein-coupled receptor G1 antikoerper, G protein-coupled receptor 56 antikoerper, ADGRG1 antikoerper, adgrg1 antikoerper, Adgrg1 antikoerper, GPR56 antikoerper

Hintergrund: GPR56 could be involved in cell-cell interactions.

Molekulargewicht: 76 kDa (MW of target protein)