Target Alle GALNT6 Antikörper anzeigen: GALNT6 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6))
Reaktivität 29 6 4 3 3 2 2 2 1 1 1: Human, Maus, Ratte
Wirt 24 5: Kaninchen
Passende Sekundärantikörper
Klonalität 27 2: Polyklonal
Konjugat 19 2 2 2 2 2: Dieser GALNT6 Antikörper ist unkonjugiert
Applikation 29 17 5 2 1 1 1 1: Western Blotting (WB)
Aufreinigung: Affinity purified
Immunogen: GALNT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRN
Top Product: Discover our top product GALNT6 Primärantikörper

GALNT6 Reaktivität: Human WB, ELISA, RNAi Wirt: Maus Monoclonal 4C10 unconjugated

anti-UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6) antibody

GALNT6 Reaktivität: Human WB, IHC, IHC (p), ICC, IF Wirt: Kaninchen Polyclonal unconjugated

GALNT6 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated

GALNT6 Reaktivität: Human, Maus, Hund, Rind (Kuh), Pferd, Kaninchen, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated

GALNT6 Reaktivität: Human, Maus, Hund WB, IHC Wirt: Kaninchen Polyclonal unconjugated

GALNT6 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB36515 unconjugated

GALNT6 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated

GALNT6 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated

GALNT6 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated

GALNT6 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare: GALNT6 Blocking Peptide, catalog no. 33R-2472, is also available for use as a blocking control in assays to test for specificity of this GALNT6 antibody
Beschränkungen: Nur für Forschungszwecke einsetzbar

Format: Lyophilized
Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT6 antibody in PBS
Konzentration: Lot specific
Buffer: PBS
Handhabung: Avoid repeated freeze/thaw cycles.
Lagerung: 4 °C/-20 °C
Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target: GALNT6 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6))
Andere Bezeichnung: GALNT6 (GALNT6 Produkte)
Synonyme: 4632410F13 antikoerper, AW047994 antikoerper, GalNAc-T6 antikoerper, fc23d02 antikoerper, fc56f12 antikoerper, wu:fc23d02 antikoerper, wu:fc56f12 antikoerper, zgc:77836 antikoerper, GALNAC-T6 antikoerper, GalNAcT6 antikoerper, galnac-t6 antikoerper, galnact6 antikoerper, polypeptide N-acetylgalactosaminyltransferase 6 antikoerper, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6) antikoerper, GALNT6 antikoerper, Galnt6 antikoerper, galnt6 antikoerper
Hintergrund: GALNT6 is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain.
Molekulargewicht: 71 kDa (MW of target protein)

GALNT6 Antikörper

Produktdetails anti-GALNT6 Antikörper