ACE2 Antikörper
-
- Target Alle ACE2 Antikörper anzeigen
- ACE2 (Angiotensin I Converting Enzyme 2 (ACE2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACE2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ACE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP
- Top Product
- Discover our top product ACE2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACE2 Blocking Peptide, catalog no. 33R-3121, is also available for use as a blocking control in assays to test for specificity of this ACE2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACE2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACE2 (Angiotensin I Converting Enzyme 2 (ACE2))
- Andere Bezeichnung
- ACE2 (ACE2 Produkte)
- Synonyme
- ACE1 antikoerper, CD143 antikoerper, DCP antikoerper, DCP1 antikoerper, ICH antikoerper, MVCD3 antikoerper, ACEH antikoerper, 2010305L05Rik antikoerper, zgc:92514 antikoerper, angiotensin I converting enzyme antikoerper, angiotensin I converting enzyme 2 antikoerper, angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 antikoerper, ACE antikoerper, ACE2 antikoerper, Ace2 antikoerper, ace2 antikoerper
- Hintergrund
- ACE2 belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this geneuggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63.
- Molekulargewicht
- 89 kDa (MW of target protein)
- Pathways
- ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour
-