GDE1 Antikörper (N-Term)
-
- Target Alle GDE1 Antikörper anzeigen
- GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GDE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- GDE1 antibody was raised against the N terminal Of Gde1
- Aufreinigung
- Affinity purified
- Immunogen
- GDE1 antibody was raised using the N terminal Of Gde1 corresponding to a region with amino acids LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN
- Top Product
- Discover our top product GDE1 Primärantikörper
-
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (AA 192-219) antibody
GDE1 Reaktivität: Human, Ratte WB, FACS Wirt: Kaninchen Polyclonal RB37323 unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (AA 42-91) antibodyGDE1 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio), Hamster, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) antibodyGDE1 Reaktivität: Human WB Wirt: Maus Monoclonal 2021CT823-61-7 unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (AA 31-138) antibodyGDE1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (AA 1-331) antibodyGDE1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (AA 31-138) antibodyGDE1 Reaktivität: Human ELISA, IF Wirt: Maus Monoclonal 2H6 unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (AA 230-242) antibodyVerified GDE1 Reaktivität: Maus, Ratte WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-Glycerophosphodiester Phosphodiesterase 1 (GDE1) (N-Term) antibodyGDE1 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio), Pferd WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GDE1 Blocking Peptide, catalog no. 33R-5401, is also available for use as a blocking control in assays to test for specificity of this GDE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))
- Andere Bezeichnung
- GDE1 (GDE1 Produkte)
- Synonyme
- zgc:56068 antikoerper, zgc:77135 antikoerper, 363E6.2 antikoerper, MIR16 antikoerper, 1200003M13Rik antikoerper, Mir16 antikoerper, RGS16 antikoerper, glycerophosphodiester phosphodiesterase 1 antikoerper, glycerophosphodiester phosphodiesterase 1 L homeolog antikoerper, gde1 antikoerper, gde1.L antikoerper, GDE1 antikoerper, Gde1 antikoerper
- Hintergrund
- GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways.
- Molekulargewicht
- 38 kDa (MW of target protein)
-
