IMPG2 Antikörper (C-Term)

Produktnummer ABIN636052

Produktdetails anti-IMPG2 Antikörper

Target: IMPG2 (Interphotoreceptor Matrix Proteoglycan 2 (IMPG2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IMPG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IMPG2 antibody was raised against the C terminal of IMPG2

Aufreinigung: Affinity purified

Immunogen: IMPG2 antibody was raised using the C terminal of IMPG2 corresponding to a region with amino acids VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IMPG2 Blocking Peptide, catalog no. 33R-9875, is also available for use as a blocking control in assays to test for specificity of this IMPG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IMPG2

Target: IMPG2 (Interphotoreceptor Matrix Proteoglycan 2 (IMPG2))

Andere Bezeichnung: IMPG2 (IMPG2 Produkte)

Synonyme: IPM200 antikoerper, RP56 antikoerper, SPACRCAN antikoerper, PG10.2 antikoerper, Rsbp antikoerper, Spacrcan antikoerper, Pg10.2 antikoerper, interphotoreceptor matrix proteoglycan 2 antikoerper, IMPG2 antikoerper, Impg2 antikoerper

Hintergrund: Interphotoreceptor matrix proteoglycan-2 (IMPG2) is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in th e fundus of the eye.

Molekulargewicht: 138 kDa (MW of target protein)