Layilin Antikörper (N-Term)

Produktnummer ABIN636057

Produktdetails anti-Layilin Antikörper

Target: Layilin (LAYN)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Layilin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LAYN antibody was raised against the N terminal of LAYN

Aufreinigung: Affinity purified

Immunogen: LAYN antibody was raised using the N terminal of LAYN corresponding to a region with amino acids CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LAYN Blocking Peptide, catalog no. 33R-1833, is also available for use as a blocking control in assays to test for specificity of this LAYN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAYN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Layilin

Target: Layilin (LAYN)

Andere Bezeichnung: LAYN (LAYN Produkte)

Synonyme: LAYN antikoerper, si:dkey-27p23.2 antikoerper, E030012M19Rik antikoerper, Gm511 antikoerper, RGD1564444 antikoerper, layilin antikoerper, layilin a antikoerper, LAYN antikoerper, layna antikoerper, Layn antikoerper

Hintergrund: LAYN contains 1 C-type lectin domain. It is the receptor for hyaluronate.

Molekulargewicht: 42 kDa (MW of target protein)