DAGLB Antikörper (Middle Region)
-
- Target Alle DAGLB Antikörper anzeigen
- DAGLB (Diacylglycerol Lipase, beta (DAGLB))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DAGLB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DAGLB antibody was raised against the middle region of DAGLB
- Aufreinigung
- Affinity purified
- Immunogen
- DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS
- Top Product
- Discover our top product DAGLB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DAGLB Blocking Peptide, catalog no. 33R-8863, is also available for use as a blocking control in assays to test for specificity of this DAGLB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAGLB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DAGLB (Diacylglycerol Lipase, beta (DAGLB))
- Andere Bezeichnung
- DAGLB (DAGLB Produkte)
- Hintergrund
- DAGLB belongs to the AB hydrolase superfamily.It catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. This protein is required for axonal growth during development and for retrograde synaptic signaling at mature synapses.
- Molekulargewicht
- 74 kDa (MW of target protein)
-