EPHX4 Antikörper (N-Term)

Produktnummer ABIN636062

Produktdetails anti-EPHX4 Antikörper

Target: EPHX4 (Epoxide Hydrolase 4 (EPHX4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPHX4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ABHD7 antibody was raised against the N terminal of ABHD7

Aufreinigung: Affinity purified

Immunogen: ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABHD7 Blocking Peptide, catalog no. 33R-3705, is also available for use as a blocking control in assays to test for specificity of this ABHD7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPHX4

Target: EPHX4 (Epoxide Hydrolase 4 (EPHX4))

Andere Bezeichnung: ABHD7 (EPHX4 Produkte)

Synonyme: ABHD7 antikoerper, EPHXRP antikoerper, Abhd7 antikoerper, Ephxrp antikoerper, Gm1382 antikoerper, epoxide hydrolase 4 antikoerper, EPHX4 antikoerper, Ephx4 antikoerper

Hintergrund: The specific function of ABHD7 is not yet known.

Molekulargewicht: 42 kDa (MW of target protein)