CTRB1 Antikörper (Middle Region)

Produktnummer ABIN636071

Produktdetails anti-CTRB1 Antikörper

Target: CTRB1 (Chymotrypsinogen B1 (CTRB1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CTRB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Chymotrypsinogen B1 antibody was raised against the middle region of CTRB1

Aufreinigung: Affinity purified

Immunogen: Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Chymotrypsinogen B1 Blocking Peptide, catalog no. 33R-2951, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsinogen B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CTRB1

Target: CTRB1 (Chymotrypsinogen B1 (CTRB1))

Andere Bezeichnung: Chymotrypsinogen B1 (CTRB1 Produkte)

Synonyme: wu:fb61f07 antikoerper, wu:fb69e12 antikoerper, CTRB1 antikoerper, 2200008D09Rik antikoerper, AI504462 antikoerper, Ctrb antikoerper, Prt-2 antikoerper, CTRB antikoerper, ctrb antikoerper, ctrb2 antikoerper, chymotrypsinogen B1 antikoerper, chymotrypsinogen B antikoerper, chymostrypsinogen B1-like antikoerper, chymotrypsinogen B1 L homeolog antikoerper, CTRB1 antikoerper, ctrb1 antikoerper, LOC618826 antikoerper, LOC713851 antikoerper, LOC479649 antikoerper, Ctrb1 antikoerper, ctrb1.L antikoerper, LOC102150576 antikoerper

Hintergrund: Alpha-chymotrypsin (EC 3.4.21.1) is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin.

Molekulargewicht: 28 kDa (MW of target protein)