Parathyroid Hormone 2 (PTH2) (Middle Region) Antikörper
-
- Target Alle Parathyroid Hormone 2 (PTH2) Antikörper anzeigen
- Parathyroid Hormone 2 (PTH2)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Hormone
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PTH2 antibody was raised against the middle region of PTH2
- Aufreinigung
- Affinity purified
- Immunogen
- PTH2 antibody was raised using the middle region of PTH2 corresponding to a region with amino acids WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
- Top Product
- Discover our top product PTH2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PTH2 Blocking Peptide, catalog no. 33R-9931, is also available for use as a blocking control in assays to test for specificity of this PTH2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTH2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Parathyroid Hormone 2 (PTH2)
- Andere Bezeichnung
- PTH2 (PTH2 Produkte)
- Substanzklasse
- Hormone
- Hintergrund
- TIP39 is related to parathyroid hormone (PTH) and PTH-related protein (PTHRP) and is a ligand for PTH receptor-2.
- Molekulargewicht
- 11 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development
-