MAGT1 Antikörper (N-Term)

Produktnummer ABIN636081

Produktdetails anti-MAGT1 Antikörper

Target: MAGT1 (Magnesium Transporter 1 (MAGT1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAGT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RP11-217 H1.1 antibody was raised against the N terminal Of Rp11-217 1.1

Aufreinigung: Affinity purified

Immunogen: RP11-217 H1.1 antibody was raised using the N terminal Of Rp11-217 1.1 corresponding to a region with amino acids ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RP11-217H1.1 Blocking Peptide, catalog no. 33R-1500, is also available for use as a blocking control in assays to test for specificity of this RP11-217H1.1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-210 1.1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAGT1

Target: MAGT1 (Magnesium Transporter 1 (MAGT1))

Andere Bezeichnung: RP11-217H1.1 (MAGT1 Produkte)

Synonyme: IAP antikoerper, MRX95 antikoerper, OST3B antikoerper, PRO0756 antikoerper, XMEN antikoerper, bA217H1.1 antikoerper, 2410001C15Rik antikoerper, 2610529C04Rik antikoerper, 2810482I07Rik antikoerper, IAG2 antikoerper, Iag2 antikoerper, magnesium transporter 1 antikoerper, MAGT1 antikoerper, Magt1 antikoerper

Hintergrund: The function of RP11-217H1.1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis