-
- Target Alle STS Antikörper anzeigen
- STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser STS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- STS antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY
- Top Product
- Discover our top product STS Primärantikörper
-
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 235-583) antibody
STS Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 1-583) antibodySTS Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 51-150) antibodySTS Reaktivität: Human WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 248-350) antibodySTS Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 1-583) antibodySTS Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) antibodySTS Reaktivität: Human WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 501-550) antibodySTS Reaktivität: Human, Ratte, Rind (Kuh), Pferd, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (Internal Region) antibodyVerified STS Reaktivität: Human WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (C-Term) antibodySTS Reaktivität: Human, Ratte, Rind (Kuh), Pferd, Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) (AA 488-517), (C-Term) antibodySTS Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
STS Blocking Peptide, catalog no. 33R-2652, is also available for use as a blocking control in assays to test for specificity of this STS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))
- Andere Bezeichnung
- STS (STS Produkte)
- Synonyme
- ARSC antikoerper, ARSC1 antikoerper, ASC antikoerper, ES antikoerper, SSDD antikoerper, XLI antikoerper, abcg2 antikoerper, ArsC antikoerper, Sts antikoerper, si:ch211-271l9.1 antikoerper, steroid sulfatase antikoerper, breast cancer resistance protein antikoerper, Steryl-sulfatase antikoerper, steryl-sulfatase antikoerper, steroid sulfatase (microsomal), isozyme S antikoerper, STS antikoerper, abcg2 antikoerper, Sts antikoerper, Plav_0360 antikoerper, Psta_3963 antikoerper, Runsl_5106 antikoerper, LOC100712701 antikoerper, sts antikoerper
- Hintergrund
- STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis.
- Molekulargewicht
- 63 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-
Sie sind hier:
