UGT1A9 Antikörper (N-Term)

Produktnummer ABIN636089

Produktdetails anti-UGT1A9 Antikörper

Target: UGT1A9 (UDP Glucuronosyltransferase 1 Family, Polypeptide A9 (UGT1A9))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UGT1A9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UGT1 A9 antibody was raised against the N terminal of µgT1 9

Aufreinigung: Affinity purified

Immunogen: UGT1 A9 antibody was raised using the N terminal of µgT1 9 corresponding to a region with amino acids LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UGT1A9 Blocking Peptide, catalog no. 33R-5168, is also available for use as a blocking control in assays to test for specificity of this µgT1A9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UGT1A9

Target: UGT1A9 (UDP Glucuronosyltransferase 1 Family, Polypeptide A9 (UGT1A9))

Andere Bezeichnung: UGT1A9 (UGT1A9 Produkte)

Synonyme: UGT1A9 antikoerper, DKFZP469N0814 antikoerper, SHEUGT1A07 antikoerper, HLUGP4 antikoerper, LUGP4 antikoerper, UDPGT antikoerper, UDPGT 1-9 antikoerper, UGT-1I antikoerper, UGT1-09 antikoerper, UGT1-9 antikoerper, UGT1.9 antikoerper, UGT1AI antikoerper, UGT1I antikoerper, UGTP4 antikoerper, Ugt1a12 antikoerper, mUGTBr/P antikoerper, Ugt1a10 antikoerper, Ugt1a11 antikoerper, UDP glycosyltransferase 1 family, polypeptide A9 antikoerper, UDP glucuronosyltransferase 1 family, polypeptide A9 antikoerper, UDP glucuronosyltransferase family 1 member A9 antikoerper, UGT1A9 antikoerper, Ugt1a9 antikoerper

Hintergrund: UGT1A9 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. UGT1A9 is active on phenols.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha