LRRC33 Antikörper (N-Term)

Produktnummer ABIN636092

Produktdetails anti-LRRC33 Antikörper

Target: LRRC33 (NRROS) (Negative Regulator of Reactive Oxygen Species (NRROS))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC33 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC33 antibody was raised against the N terminal of LRRC33

Aufreinigung: Affinity purified

Immunogen: LRRC33 antibody was raised using the N terminal of LRRC33 corresponding to a region with amino acids GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC33 Blocking Peptide, catalog no. 33R-3389, is also available for use as a blocking control in assays to test for specificity of this LRRC33 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC33 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC33

Target: LRRC33 (NRROS) (Negative Regulator of Reactive Oxygen Species (NRROS))

Andere Bezeichnung: LRRC33 (NRROS Produkte)

Synonyme: GARPL1 antikoerper, LRRC33 antikoerper, UNQ3030 antikoerper, negative regulator of reactive oxygen species antikoerper, NRROS antikoerper

Hintergrund: The function of LRRC33 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 76 kDa (MW of target protein)