Klotho Antikörper (Middle Region)
-
- Target Alle Klotho (KL) Antikörper anzeigen
- Klotho (KL)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Klotho Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Klotho antibody was raised against the middle region of KL
- Aufreinigung
- Affinity purified
- Immunogen
- Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids HRGYSIRRGLFYVDFLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLE
- Top Product
- Discover our top product KL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Klotho Blocking Peptide, catalog no. 33R-3841, is also available for use as a blocking control in assays to test for specificity of this Klotho antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Klotho (KL)
- Andere Bezeichnung
- Klotho (KL Produkte)
- Synonyme
- alpha-kl antikoerper, KL antikoerper, LOC100223456 antikoerper, klotho antikoerper, Klotho antikoerper, KL antikoerper, Kl antikoerper, kl antikoerper, LOC100533542 antikoerper
- Hintergrund
- This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production of this protein has been observed in patients with chronic renal failure (CRF), and this may be one of the factors underlying the degenerative processes.
- Molekulargewicht
- 116 kDa (MW of target protein)
- Pathways
- Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Hormone Activity, Growth Factor Binding
-