IZUMO1 Antikörper (C-Term)
-
- Target Alle IZUMO1 Antikörper anzeigen
- IZUMO1 (Izumo Sperm-Egg Fusion 1 (IZUMO1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IZUMO1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IZUMO1 antibody was raised against the C terminal of IZUMO1
- Aufreinigung
- Affinity purified
- Immunogen
- IZUMO1 antibody was raised using the C terminal of IZUMO1 corresponding to a region with amino acids SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ
- Top Product
- Discover our top product IZUMO1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IZUMO1 Blocking Peptide, catalog no. 33R-8575, is also available for use as a blocking control in assays to test for specificity of this IZUMO1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IZUMO1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IZUMO1 (Izumo Sperm-Egg Fusion 1 (IZUMO1))
- Andere Bezeichnung
- IZUMO1 (IZUMO1 Produkte)
- Hintergrund
- The sperm-specific protein Izumo, named for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion.
- Molekulargewicht
- 39 kDa (MW of target protein)
-